PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00018-augustus-gene-0.30-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 406aa    MW: 46499.8 Da    PI: 6.118
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00018-augustus-gene-0.30-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.6e-51151431128
                                            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfF 61 
                                                    +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi+evd++k+ePwd+++k+k     +++wyfF
  maker-scaffold00018-augustus-gene-0.30-mRNA-1  15 VPPGFRFHPTEEELLHYYLRKKVAYEKIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFF 77 
                                                    69****************************.9***************964444222455***** PP

                                            NAM  62 skrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmhe 125
                                                    s++dkky+tg+r+nrat++g+Wkatg+dk ++s + + +gl+ktLvfykgrap+g+k+dW+mhe
  maker-scaffold00018-augustus-gene-0.30-mRNA-1  78 SHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS-GFKRIGLRKTLVFYKGRAPHGQKSDWIMHE 140
                                                    *********************************.9999************************** PP

                                            NAM 126 yrl 128
                                                    yrl
  maker-scaffold00018-augustus-gene-0.30-mRNA-1 141 YRL 143
                                                    *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-5710173IPR003441NAC domain
PROSITE profilePS5100556.34415173IPR003441NAC domain
PfamPF023659.5E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MAEDMNLSIN GQSQVPPGFR FHPTEEELLH YYLRKKVAYE KIDLDVIREV DLNKLEPWDI  60
QEKCKIGSTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKIIYS GFKRIGLRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDENIHDT NVSNSVGESM AEDGWVVCRV FKKKNYQKAL  180
ESPKTSSMSM DSNNELLASR NDEVLDQILM YMGRTCKLEN ESFNISDNSN PLRFLTAKQT  240
SNFSEGLHDR FMHLPRLESP TLPSLPINNS PFDHQDHNFK ACYPTFDEML NETEPSTTNQ  300
ASGCDTHTTP VDDHDPKTRL SDWVAFDRMV ASQLNGQEET TKQLSCFSDP NMGFCPPHHD  360
DVQLSDLRTS RLGQVSPVYN TTENDIWSFT KSSSPSSSDP LSHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-491517515170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279545.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-119NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0U3SLK10.0A0A0U3SLK1_BETPL; NAC transcription factor
STRINGVIT_02s0025g02710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-108NAC family protein